Protein Info for H281DRAFT_04042 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): phenylacetate transporter
Rationale: Specifically important for phenylacetate utilization.
Original annotation: aromatic amino acid:proton symporter, AAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 107 (17 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 319 to 344 (26 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 444 to 465 (22 residues), see Phobius details amino acids 471 to 490 (20 residues), see Phobius details PF00324: AA_permease" amino acids 63 to 499 (437 residues), 417.3 bits, see alignment E=8e-129 PF13520: AA_permease_2" amino acids 67 to 484 (418 residues), 119.6 bits, see alignment E=1.7e-38

Best Hits

Swiss-Prot: 71% identical to AROP_SHIFL: Aromatic amino acid transport protein AroP (aroP) from Shigella flexneri

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 97% identity to bgf:BC1003_2709)

MetaCyc: 71% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFR8 at UniProt or InterPro

Protein Sequence (506 amino acids)

>H281DRAFT_04042 phenylacetate transporter (Paraburkholderia bryophila 376MFSha3.1)
VPVRCKKSAGWYQYLGNIGRGKIFGSAGADHKSGRAIEIHTLGRNLDNALQQDGLKRGLK
NRHIQLIALGGAIGTGLFLGSASVLQAAGPSMILGYAIGGVIAFMIMRQLGEMVAQEPVA
GSFSHFAYKYWGDFPGFLSGWNYWVLYVLVSMAELTAVGTYVHYWWPGVPTWVSALVCFA
GINAINLANVKAYGETEFWFAIIKVVAVIGMILFGGYLLVSGHGGPQASISNLWSHGGFF
PHGFHGLFTMLAVIMFSFGGLELIGITAAEADEPQKSIPKAVNQVIYRILIFYICSLAVL
LSLYPWNEVAAGGSPFVMIFSQIGSTLTANVLNVVVLTAALSVYNSGVYANSRMLYGLAE
QGNAPRALMKVDRRGVPYMAIGLSALATFTCVIVNYLIPAEALGLLMALVVAALVLNWAL
ISLTHLKSRRAMVAAGETLVFKSFWFPVSNWICLAFMALILVILAMTPGLSVSVLLVPVW
LVVMWAGYAFKRRRAAAHVAARVVGR