Protein Info for H281DRAFT_04026 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 3-octaprenyl-4hydroxybenzoate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 288 (283 residues), 259.3 bits, E=3e-81
  • amino acids 311 to 490 (180 residues), 251.8 bits, E=5.5e-79
• PF20695: UbiD_N
  • amino acids 11 to 79 (69 residues), 81.2 bits, E=7.5e-27
• PF01977: UbiD
  • amino acids 131 to 357 (227 residues), 259.4 bits, E=2.5e-81
• PF20696: UbiD_C
  • amino acids 363 to 487 (125 residues), 158 bits, E=1.8e-50

Best Hits

Swiss-Prot: 95% identical to UBID_PARPJ: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 96% identity to bgf:BC1003_2695)

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

See A0A2Z5MCX9 at UniProt or InterPro

Protein Sequence (522 amino acids)

>H281DRAFT_04026 3-octaprenyl-4hydroxybenzoate decarboxylase (Paraburkholderia bryophila 376MFSha3.1)
MKYKDLRDFIGRLETIGELRRIPQKVSPVLEMTELCDRVLRAGGPALLFENQEAHAFPVL
GNLFGTPRRVALGMGIDAEAGEGDGAALDSLRDVGRLLSALKEPEPPKGLKDAGKLFSLA
KAVWDMAPRTVSAPPCQEIVWEGNDVDLEKLPIQTCWPGDAGPLITWGLTVTKGPNKSRQ
NLGIYRQQLIGRNKLIMRWLAHRGGALDFREFALKNPGQPYPVAVVLGADPATILGAVTP
VPDTLSEYQFAGLLRGARTELAKCITPGVDGLQVPARAEIVLEGFIYPQVGAPPPAPAGA
PPRPAKGASAAYEHALEGPYGDHTGYYNEQEWFPVFTVERITMRRDAIYHSTYTGKPPDE
PAVLGVALNEVFVPLLQKQFSEITDFYLPPEGCSYRMAIVQMKKSYPGHAKRVMFGVWSF
LRQFMYTKFIVVVDEDVNIRDWKEVIWAITTRVDPTRDTVLVDRTPIDYLDFASPVAGLG
SKMGLDATNKWPGETDREWGRPIEMSAAVKQRIDSLWNELGL