Protein Info for H281DRAFT_04016 in Paraburkholderia bryophila 376MFSha3.1

Annotation: MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 57 to 76 (20 residues), see Phobius details amino acids 83 to 111 (29 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 262 to 287 (26 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 385 to 411 (27 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 56 to 425 (370 residues), 310.8 bits, see alignment E=9e-97 PF07690: MFS_1" amino acids 65 to 403 (339 residues), 155.6 bits, see alignment E=1.7e-49 PF00083: Sugar_tr" amino acids 96 to 243 (148 residues), 42.6 bits, see alignment E=4e-15

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 95% identity to bug:BC1001_2717)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFI5 at UniProt or InterPro

Protein Sequence (450 amino acids)

>H281DRAFT_04016 MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (Paraburkholderia bryophila 376MFSha3.1)
MLRLVLAAGEVDALTVAYNRCDQLQSFCIPARRFSEDARFTWIPMSHVTGRRPDGRLILL
LGALAACGPISIDMYLPSLPTIAQAFAIGTGAAQTTLTSFMFGFSIGMLLYGPLSDTYGR
RPVLLGGIIMYALASIACTLSFSIGALVTFRFVQALGAGAASVLARAIARDAYGPTDAAR
VLSMLAIVTSIGPLLAPLIGGQLLLLGGWRVVFIALTLFGMVCAITAFLKVPETWPREKR
AHSALFKSFAAYGRLLRDPVAWGHMLCGGMAFASMFAYITATPFVYIQYFHVSAQHYGFL
FALNIVGIMLGNFMNTRLVGRLGSLPIISFAASVSCIASLFVCLVSLTGWGGLWSIVAGL
FFVVGVVGLLSANCTTDLMHRYPVNAGAAAAVFGAVQLALGALSSLAVGLWQDGSPKGMG
VVVGVAGSLCYVGRILVVRWHGTKAPVAVV