Protein Info for H281DRAFT_04000 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcription elongation factor GreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR01461: transcription elongation factor GreB" amino acids 45 to 200 (156 residues), 219.9 bits, see alignment E=6.6e-70 PF03449: GreA_GreB_N" amino acids 47 to 117 (71 residues), 84.2 bits, see alignment E=5.9e-28 PF01272: GreA_GreB" amino acids 126 to 199 (74 residues), 80.3 bits, see alignment E=8.1e-27

Best Hits

Swiss-Prot: 47% identical to GREB_PSEAE: Transcription elongation factor GreB (greB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 94% identity to bgf:BC1003_2674)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFH4 at UniProt or InterPro

Protein Sequence (206 amino acids)

>H281DRAFT_04000 transcription elongation factor GreB (Paraburkholderia bryophila 376MFSha3.1)
MIVYPSGAAVCCSLWIIMNKAFVKESSDDNDDDLDVAQPEIPAGTKNYITPAGYHRMRDE
LLHLIDVDRPEVVKLVSWAASNGDRSENGDYIYGKRRLREIDRRIRFLTKRLDLAEVVDS
SKQENVDQVFFGATVEYATEDGQEHTVTIVGIDEVDLDIGHVSWISPIARALLKAKVGDT
VTLYTPAGPQPIDILDVKYPPAKSDI