Protein Info for H281DRAFT_03991 in Paraburkholderia bryophila 376MFSha3.1
Annotation: D-fructose 1,6-bisphosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to F16PA_PARPJ: Fructose-1,6-bisphosphatase class 1 (fbp) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 98% identity to bxe:Bxe_A0920)Predicted SEED Role
"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)
MetaCyc Pathways
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- gluconeogenesis I (12/13 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
- glycolysis II (from fructose 6-phosphate) (10/11 steps found)
- Calvin-Benson-Bassham cycle (11/13 steps found)
- glycolysis I (from glucose 6-phosphate) (11/13 steps found)
- gluconeogenesis III (10/12 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- ethene biosynthesis V (engineered) (19/25 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- superpathway of N-acetylneuraminate degradation (16/22 steps found)
- oxygenic photosynthesis (12/17 steps found)
- superpathway of hexitol degradation (bacteria) (12/18 steps found)
KEGG Metabolic Maps
- Biosynthesis of phenylpropanoids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.11
Use Curated BLAST to search for 3.1.3.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MD16 at UniProt or InterPro
Protein Sequence (338 amino acids)
>H281DRAFT_03991 D-fructose 1,6-bisphosphatase (Paraburkholderia bryophila 376MFSha3.1) MSLQRRTTLTKYLIEQQRETNNLPADLRLLIEVVARACKAISYHVSKGALGDALGTAGSE NVQGEVQKKLDILSNEILLEANEWGGNLAGMASEEMEQFFPIPANYPKGEYLLVFDPLDG SSNIDVNVSIGTIFSVLRCPDGQQPTEQSFLQPGTEQVAAGYAVYGPQTVLVLTTGNGVN CFTLDRELGSWVLTQSDMRIPVETREYAINASNERHWYPPVEQYIGELKQGKDGPRQSDF NMRWIASMVADVHRILNRGGIFMYPADKRTPEKPGKLRLMYEANPMAFIVEQAGGAATNG EKRILDIQPKSLHERVAVFLGSKNEVDRVTRYHLETKK