Protein Info for H281DRAFT_03979 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted acyltransferase, LPLAT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 PF00535: Glycos_transf_2" amino acids 6 to 136 (131 residues), 70 bits, see alignment E=3.6e-23 PF13641: Glyco_tranf_2_3" amino acids 7 to 94 (88 residues), 30.1 bits, see alignment E=6.6e-11 PF03279: Lip_A_acyltrans" amino acids 356 to 565 (210 residues), 32.5 bits, see alignment E=7.9e-12

Best Hits

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_2687)

Predicted SEED Role

"FIG143263: Glycosyl transferase / Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>H281DRAFT_03979 Predicted acyltransferase, LPLAT superfamily (Paraburkholderia bryophila 376MFSha3.1)
MNFAPCIVIPIYNHKDAIGATVAHLAVHGLPIFVVDDGSDEATQQVLAELASEYAAQLTL
LRLPVNGGKGAAVMAGLRAARDAHYTHALQIDADGQHDATDVPRFIEAARAEPGAVILGR
PVYDESVPKARLYGRYLTHVWVWIETLSLTIRDSMCGFRLYPLALACDLIDSVQLPTRMD
FDIEILVRLYWRRAAFRSIPTRVTYASDGVSHFDVLWDNVRISRSHTRLVCGMLARLPML
LAHKFMPRRAAPAGARSKQSGGAEAQDWWRIAERGSHLGMSLLALSCKLFGRRFTGLWLH
PIVAYFLLTGRAAREASANYFRRLHEAEPRGDTPRPGWLSAYRHMLAFAQSGFDKLAAWS
GRVNNADVQFEDPSAFEALVASGKGALVIGAHLGNLEMTRALAAQGAYAKVTAVVYTEHA
RRFNSVLASANSEFTRHLLEVADFGPETAMMMQERVDAGELLVIVGDRVPAHEAGRTTEA
RFLGVTAPFAQGPYVLAHALGCPVYLFFCLKEHDGYRLYFEPFAERIELPRRERTQHLAA
WAQRYAVRLEHYCRKAPYQWFNFFDFWARPKRDANGRT