Protein Info for H281DRAFT_03977 in Paraburkholderia bryophila 376MFSha3.1

Annotation: (3S)-malyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 19 to 128 (110 residues), 69 bits, see alignment E=2.3e-23 PF13279: 4HBT_2" amino acids 20 to 130 (111 residues), 59.5 bits, see alignment E=4.6e-20 PF03061: 4HBT" amino acids 28 to 94 (67 residues), 31.3 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 93% identity to bxe:Bxe_A0934)

Predicted SEED Role

"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MI46 at UniProt or InterPro

Protein Sequence (146 amino acids)

>H281DRAFT_03977 (3S)-malyl-CoA thioesterase (Paraburkholderia bryophila 376MFSha3.1)
MSMTESATRKVLSASAMVEVPFHDVDAMNVCWHGHYLKYFEIGRAALLRAFDYDYREMQA
SGYLWPIVEAHLKYVRPATYGQKIDVRTQLLEHENRLKIGYEIIDCESGTRLTKGYTIQV
AVDAATQELQFVSPPVVFEKLERVWR