Protein Info for H281DRAFT_03975 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 829 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 321 to 346 (26 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 443 to 460 (18 residues), see Phobius details amino acids 671 to 690 (20 residues), see Phobius details amino acids 711 to 733 (23 residues), see Phobius details amino acids 739 to 759 (21 residues), see Phobius details amino acids 770 to 792 (23 residues), see Phobius details amino acids 801 to 820 (20 residues), see Phobius details PF03176: MMPL" amino acids 209 to 437 (229 residues), 40 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to bug:BC1001_2683)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (829 amino acids)

>H281DRAFT_03975 Predicted exporter (Paraburkholderia bryophila 376MFSha3.1)
MDLLQHRSAKNAWGMRAAWLLLALVAALYCGWRFSGPSPLQTNLLALLPATEADPVAEKA
VDTLASALGDRTVFLVTSHDDAHAKAAAKQLGASLQKSGAFASVTAELPPFDLSQITALY
LPYRFGLLTPADRAAIAGSKAPDAALRDALAQRIYSPVRGGLTTSLADDPFGWLEHWLGN
LPLATSNLELEDGLLVSHQDGHQGTATSVLIVATLPGSAYETKTQHAVLAALSQGESALK
QAFPDVSVARTGAVFYAESARSASEREVHLIGVASLIGIALLMMWVFRSPRLLLLGFVST
ALGIVCALAVTLLVFGKLHLLTLVFGASLIGEAVDYSIQYFVVYLGAGRDWDARRGARAV
RPALSVALATSLLGYAILTWVPFPALKQIACFAMAGIVTAFASVMWLLPALLPHAPKRSP
RRLFERSARLLSAWHRLIGGKRAWIVAALLLIVAIPGWLRLTSDDDVHLLIQRDPSLVAQ
EDKVRNAVGIDNSAQFFVVRGETPELVLERAEALGAKLDALGGTPNGVGGYQSVAQFVPS
AQQQNRDRALLAQHVFDDTAALRATLLQAGFKDEVADAWIAAEKNAQTKPQSLLTVDQWL
AAPWSQPYRHLWLGQVDAATKAYAAVVIPQGVTSRNEAALIATARSVPGVAFVDKAASVS
KLFGAYRVDSGWWLGGALTLVLILLIVRYARKQPDSGHAANEVPLAHRMRGGIAVTLPVL
LAVGVTLAVFGYARVPLNLFNWLALMLVLGVGANYAVFLREGCMRTDADLGAVWTGVLLS
AATTLLSFGMLGMSAMPALKSFGATLALGIAVSVLLAPIGMPSESRRAA