Protein Info for H281DRAFT_03964 in Paraburkholderia bryophila 376MFSha3.1

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00962: A_deaminase" amino acids 17 to 340 (324 residues), 301.3 bits, see alignment E=4.3e-94 TIGR01430: adenosine deaminase" amino acids 17 to 338 (322 residues), 374.3 bits, see alignment E=2.4e-116

Best Hits

Swiss-Prot: 94% identical to ADE_PARPJ: Adenine deaminase (Bphyt_3044) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 96% identity to bgf:BC1003_2641)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MCZ4 at UniProt or InterPro

Protein Sequence (348 amino acids)

>H281DRAFT_03964 adenosine deaminase (Paraburkholderia bryophila 376MFSha3.1)
MNTTTATSLIEKAMLAPKAELHIHIEGSLEPELIFALAERNGVKLAYDSIEALRAAYAFT
DLQSFLDIYYAGASVLLHEQDFYDMTMAYVERCLADNVIHSEIFFDPQTHTERGVPIATV
VAGIERALADAEKRGMSSKLILCFLRHLSEEDALATFEEARPLFDQYKHRLIGVGLDSSE
RGHPPSKFERVFAKARALGLKLVAHAGEEGPPSYIYEALDLLKVDRVDHGVRSIEDPALV
ARLADTRVALTVCPLSNLKLCVFDDMTKHTLKDLLDRGVAVTVNSDDPAYFGGYVNANYA
ATIDALKLDDAEVYTIIRNGFEASFVTPQERAELIAKLDAHWNQSGPH