Protein Info for H281DRAFT_03964 in Paraburkholderia bryophila 376MFSha3.1

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00962: A_deaminase
  • amino acids 17 to 340 (324 residues), 301.3 bits, E=4.3e-94
• TIGR01430: adenosine deaminase
  • amino acids 17 to 338 (322 residues), 374.3 bits, E=2.4e-116

Best Hits

Swiss-Prot: 94% identical to ADE_PARPJ: Adenine deaminase (Bphyt_3044) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 96% identity to bgf:BC1003_2641)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• adenine and adenosine salvage III (2/4 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• purine deoxyribonucleosides degradation II (1/3 steps found)
• purine deoxyribonucleosides degradation I (1/4 steps found)
• superpathway of purine deoxyribonucleosides degradation (3/7 steps found)
• purine ribonucleosides degradation (1/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

See A0A2Z5MCZ4 at UniProt or InterPro

Protein Sequence (348 amino acids)

>H281DRAFT_03964 adenosine deaminase (Paraburkholderia bryophila 376MFSha3.1)
MNTTTATSLIEKAMLAPKAELHIHIEGSLEPELIFALAERNGVKLAYDSIEALRAAYAFT
DLQSFLDIYYAGASVLLHEQDFYDMTMAYVERCLADNVIHSEIFFDPQTHTERGVPIATV
VAGIERALADAEKRGMSSKLILCFLRHLSEEDALATFEEARPLFDQYKHRLIGVGLDSSE
RGHPPSKFERVFAKARALGLKLVAHAGEEGPPSYIYEALDLLKVDRVDHGVRSIEDPALV
ARLADTRVALTVCPLSNLKLCVFDDMTKHTLKDLLDRGVAVTVNSDDPAYFGGYVNANYA
ATIDALKLDDAEVYTIIRNGFEASFVTPQERAELIAKLDAHWNQSGPH