Protein Info for H281DRAFT_03961 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): xanthine dehydrogenase, small subunit (EC 1.17.1.4)
Rationale: Specific phenotype: utilization of 2-Deoxyadenosine 5-monophosphate
Original annotation: xanthine dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 34 to 513 (480 residues), 697.1 bits, E=4.9e-214
• PF00111: Fer2
  • amino acids 39 to 87 (49 residues), 22.2 bits, 2.2e-08
• PF01799: Fer2_2
  • amino acids 114 to 191 (78 residues), 107 bits, E=8.4e-35
• PF00941: FAD_binding_5
  • amino acids 240 to 404 (165 residues), 178.9 bits, E=1.6e-56
• PF03450: CO_deh_flav_C
  • amino acids 411 to 512 (102 residues), 113.2 bits, E=1.2e-36

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 92% identity to bug:BC1001_2669)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation I (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See A0A2Z5MF89 at UniProt or InterPro

Protein Sequence (542 amino acids)

>H281DRAFT_03961 xanthine dehydrogenase, small subunit (EC 1.17.1.4) (Paraburkholderia bryophila 376MFSha3.1)
MAIYVREAGFGATPCVTRARSALSSGFAMTTQTIRFYRQGSVHEVSGVPASRTVLQHLRE
DLHCTGTKEGCAEGDCGACTVVIGELDAQGALALKAVNACIQFLPTLDGKALFTVEDLRA
ADGTLHPVQQAMVDCHGSQCGFCTPGFVMSMWALYENQPAAAGLPTRDEINTALSGNLCR
CTGYRPIVDASQKMFDYAQYPRVTLDRKAVEETLRALQRNDTFEYRAPDARGAAFGAPAF
YAPLTLDAFARLRAEHPQARLVAGSTDVGLWVTKQFRDLGDVLYIGNVRELKTIERDAQT
LTIGAAVTLEDAYAALAADYPELAELWTRFASLPIRNAGTLGGNVANGSPIGDSMPALLA
LGAEVVLRHGTKTRTLPLDGFYLGYQKTALAAGEFVAALRVPRPAGNLRFRTYKVSKRYD
QDISAVCAAFALHIDEGSTIVAARVAFGGMAATPKRATQTEAVLSGATWNESTARQAMNA
LTADYQPLTDMRASSAYRLKVARNLLWRFHLETREDAPLALFDVNAFAFEAGTPDAVVKE
PS