Protein Info for H281DRAFT_03947 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Tetratricopeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 23 to 81 (59 residues), 34.1 bits, 3.2e-11
  • amino acids 85 to 149 (65 residues), 48.9 bits, E=7.1e-16
  • amino acids 127 to 182 (56 residues), 43.4 bits, 3.9e-14
  • amino acids 189 to 251 (63 residues), 38.3 bits, E=1.5e-12
  • amino acids 256 to 304 (49 residues), 24.4 bits, 3.5e-08
  • amino acids 291 to 341 (51 residues), 25.1 bits, 2e-08
• PF13181: TPR_8
  • amino acids 48 to 80 (33 residues), 16.4 bits, see alignment (E = 8.7e-06)
  • amino acids 83 to 113 (31 residues), 20.9 bits, see alignment (E = 3.1e-07)
  • amino acids 117 to 148 (32 residues), 20.5 bits, see alignment (E = 4.3e-07)
  • amino acids 149 to 181 (33 residues), 24.8 bits, see alignment (E = 1.8e-08)
  • amino acids 184 to 214 (31 residues), 16.5 bits, see alignment (E = 7.8e-06)
  • amino acids 219 to 249 (31 residues), 18.4 bits, see alignment (E = 1.9e-06)
  • amino acids 253 to 283 (31 residues), 19 bits, see alignment (E = 1.2e-06)
  • amino acids 287 to 317 (31 residues), 12.9 bits, see alignment (E = 0.00011)
• PF07721: TPR_4
  • amino acids 49 to 72 (24 residues), 12.4 bits, see alignment (E = 0.00023)
  • amino acids 115 to 140 (26 residues), 18.1 bits, see alignment (E = 3.4e-06)
  • amino acids 151 to 174 (24 residues), 15.7 bits, see alignment (E = 1.9e-05)
  • amino acids 319 to 339 (21 residues), 11.1 bits, see alignment (E = 0.0006)
• PF13176: TPR_7
  • amino acids 49 to 80 (32 residues), 14.8 bits, see alignment (E = 2.7e-05)
  • amino acids 117 to 148 (32 residues), 21.7 bits, see alignment (E = 1.6e-07)
  • amino acids 152 to 180 (29 residues), 20 bits, see alignment (E = 5.6e-07)
• PF14559: TPR_19
  • amino acids 59 to 101 (43 residues), 30.4 bits, 4.4e-10
  • amino acids 93 to 150 (58 residues), 31.8 bits, 1.6e-10
  • amino acids 126 to 181 (56 residues), 26.9 bits, 5.3e-09
  • amino acids 195 to 249 (55 residues), 25.4 bits, 1.5e-08
  • amino acids 231 to 288 (58 residues), 25.2 bits, 1.8e-08
• PF13424: TPR_12
  • amino acids 81 to 145 (65 residues), 31.7 bits, E=1.5e-10
  • amino acids 117 to 179 (63 residues), 42.2 bits, E=8.1e-14
  • amino acids 149 to 211 (63 residues), 39.5 bits, E=5.5e-13
• PF07719: TPR_2
  • amino acids 82 to 113 (32 residues), 24.1 bits, see alignment (E = 2.8e-08)
  • amino acids 116 to 148 (33 residues), 31.4 bits, see alignment (E = 1.3e-10)
  • amino acids 150 to 182 (33 residues), 27.9 bits, see alignment (E = 1.8e-09)
• PF13428: TPR_14
  • amino acids 82 to 123 (42 residues), 24.1 bits, 3.9e-08
• PF13374: TPR_10
  • amino acids 82 to 110 (29 residues), 15.2 bits, see alignment (E = 2e-05)
  • amino acids 150 to 179 (30 residues), 21.3 bits, see alignment (E = 2.3e-07)
  • amino acids 183 to 211 (29 residues), 15 bits, see alignment (E = 2.2e-05)
• PF00515: TPR_1
  • amino acids 84 to 114 (31 residues), 28.4 bits, see alignment (E = 1.1e-09)
  • amino acids 117 to 148 (32 residues), 34.2 bits, see alignment (E = 1.6e-11)
  • amino acids 149 to 181 (33 residues), 33.5 bits, see alignment (E = 2.7e-11)
• PF13414: TPR_11
  • amino acids 88 to 125 (38 residues), 42.1 bits, 6.1e-14
  • amino acids 122 to 163 (42 residues), 39.7 bits, 3.3e-13
• PF13174: TPR_6
  • amino acids 117 to 147 (31 residues), 13.8 bits, see alignment (E = 8.5e-05)
• PF13431: TPR_17
  • amino acids 137 to 170 (34 residues), 27.4 bits, see alignment (E = 2.8e-09)

Best Hits

KEGG orthology group: None (inferred from 91% identity to bug:BC1001_2657)

Predicted SEED Role

"TPR repeat"

Sequence Analysis Tools

See A0A2Z5MFE2 at UniProt or InterPro

Protein Sequence (627 amino acids)

>H281DRAFT_03947 Tetratricopeptide repeat-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MRPLPHPTTIPVMQPVFDRAFAAHRDGRLEDAERGYRATLDGNPVHVDALHLLGVLRHQQ
GQHAEAAELVRRAVDLRPQDAALQLNLGNALKALGQIDEAIDQFRNALTLAPSFPMAHYN
LGNAYTAAGRHEDAADAFRRSLRLQPDDASSHNNLGNALHALGRHEEAIASFRRTLELRP
GHAGALNNMGMSLNALGRANEAIPCFKAALAAEPRFVAAHFNLANTFDATGLHAEAVASF
EAALALQPNLPPAIFGMGNALAALGRHAQAIPYLERSVGLDPQFALAWLSLGTAHQALGA
HATAVRAFDQALRVQPDLASAHMNRALAWLALGDFARGLPEYEWRLQTVAEPAIETLPRW
HGEPVSQRTLLIHAEQGFGDTLQFVRFIPLAAQRAARVVLELQPQLLPLLEPAAQAWRVT
LIPRGAPRPAADLQCPLLSLPLALGTTLDTIPERTPYLTVPPAYRRKWRGSLGGQAKRKI
GLAWSGRIHQNETRSMPLAELDPLFAIEGIDWIVLQPNLSADECAALDAHPRAGSIHRFD
KRIDDFADTAAIIERLDAVVSIDTSIAHLAGALRKPLWLMLPFAPDWRWCADDTRSPWYA
SATLVRQPQPDAWREVVQAVANELRRS