Protein Info for H281DRAFT_03945 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cobalt-zinc-cadmium efflux system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 142 to 164 (23 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 243 to 267 (25 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 145 to 413 (269 residues), 232.5 bits, see alignment E=3.2e-73 PF01545: Cation_efflux" amino acids 147 to 333 (187 residues), 135.6 bits, see alignment E=9.6e-44

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 78% identity to bug:BC1001_2655)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>H281DRAFT_03945 cobalt-zinc-cadmium efflux system protein (Paraburkholderia bryophila 376MFSha3.1)
MKKIEEREDEHAPVWLDATDNNEVAGTQSRVAGTRVHEDSDRGVVAGERSARGFEQDGHG
DGRDHSHAAGHSHDHSGSHDQPHGHDHSHGHGHDHSHDHGHDHGHDHGHDDSHSHGGGHS
HGHSHAHAGHHHHHHAPVAGHGFAFALAVALNVAIVVIQALYGVLAHSTALLADAGHNLS
DVLGLLLAWGAAWLTTRRPSARYTFGYGSSSILASLANAALLLFACGVIVAEAIGRLMNP
APVAGLAVFVVATVGVVVNGISAWLFMRGQKEDLNIRGAFLHMAADAGVSAAVAISGLVI
LYTNWTWLDPVMSLLVVAVVVYGTWGLLRDSVRLALNAVPSGVDLQSIRDYLADLPGVEG
VHDLHVWALSTTGNALSVHLVMPAGHPGDERLDGIVLALRERFSMQHATLQVDLGTTSHR
CAMEHPAEQH