Protein Info for H281DRAFT_03934 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ATP-binding cassette, subfamily B, RaxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 transmembrane" amino acids 158 to 182 (25 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 396 to 420 (25 residues), see Phobius details PF03412: Peptidase_C39" amino acids 3 to 129 (127 residues), 87.6 bits, see alignment E=1.4e-28 PF00664: ABC_membrane" amino acids 161 to 425 (265 residues), 89.2 bits, see alignment E=7.9e-29 PF00005: ABC_tran" amino acids 494 to 643 (150 residues), 88.3 bits, see alignment E=1.5e-28 PF13304: AAA_21" amino acids 611 to 673 (63 residues), 34.1 bits, see alignment E=6e-12

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_2644)

Predicted SEED Role

"Toxin secretion ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (700 amino acids)

>H281DRAFT_03934 ATP-binding cassette, subfamily B, RaxB (Paraburkholderia bryophila 376MFSha3.1)
MRAIYQNEVAECGYACLAMVLSHFGRAIEVRELQAFRPISANGLSLMDLYDVAVEFGLAV
QAYRFDAGDLPSIKRGSILHFGGAHFVVFENCGRGYVKVIDPASGRRRISMDTFVANVSG
YLLECAPTPAMPRVRNKSRVPGALARVRALNPQLTAQIAKVMFVALGSQFAILAMPYLGN
LLLDDVVAADNLNLLNVLMLTFAGIFIVGALSQYVQTYLVELLHGLVQMNMTEGIVAQLL
RNPIPYFEKRHVGDLFARVKAQDEISAFTTRTTISSGIDVAVGMLALALMLVQSRQLTLI
AVLIFMVYVAVSFALFSRMRDTHALVLEESARCDDTLIETIRAASLIKLSQGEARRTAIF
MGKYRAYMAALVKNSRFASARDAILKLVDYADMIAVSWFAARLMLSGTISVGVFYSFLIY
KSLLSERFARAVNAAFEYFMLSVPVARVGDIVDGEAERYTEPGEMHKAVEVRTFERIDVR
GVTFRYGVSDQPVLKDANIVIRRGDKIVITGASGTGKSTLFKLLAAAEPLQEGEITLNGI
AWPNLSVDEIRRHAVHMRQGDLILHGSIADNVSLFAGNADEARIHALLDDVGLLPDVMRL
PMRTRTVISDTIANISAGQRQRLLLARALYQQRELLLLDEPTSNLDPASVRHVVDLLLRL
ERTVVVITHDMSLASAFDTRYRLVDGELRCEARERVLTDE