Protein Info for H281DRAFT_03913 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ADP-glyceromanno-heptose 6-epimerase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 172 (172 residues), 41.8 bits, see alignment E=2.1e-14 TIGR02197: ADP-glyceromanno-heptose 6-epimerase" amino acids 3 to 327 (325 residues), 449.9 bits, see alignment E=2.4e-139 PF16363: GDP_Man_Dehyd" amino acids 4 to 254 (251 residues), 59.6 bits, see alignment E=1.1e-19 PF01073: 3Beta_HSD" amino acids 4 to 179 (176 residues), 36.5 bits, see alignment E=8.7e-13 PF01370: Epimerase" amino acids 4 to 241 (238 residues), 153 bits, see alignment E=2.8e-48

Best Hits

Swiss-Prot: 97% identical to HLDD_PARPJ: ADP-L-glycero-D-manno-heptose-6-epimerase (hldD) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03274, ADP-L-glycero-D-manno-heptose 6-epimerase [EC: 5.1.3.20] (inferred from 97% identity to bpy:Bphyt_2995)

Predicted SEED Role

"ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20)" in subsystem LOS core oligosaccharide biosynthesis (EC 5.1.3.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF50 at UniProt or InterPro

Protein Sequence (330 amino acids)

>H281DRAFT_03913 ADP-glyceromanno-heptose 6-epimerase precursor (Paraburkholderia bryophila 376MFSha3.1)
MTLIVTGAAGFIGSNLVKALNERGEQRIIAVDNLTRADKFKNLVDCEIDDYLDKTEFVER
SKRGDFGKVRAIFHEGACSDTMETDGRYMMENNFRYSRDVLDVCLAQNIQFLYASSAATY
GGSNRFVEEREVEQPLNVYGYSKFLFDQVVRRVLPTARSQIAGFRYFNVYGPRETHKARM
ASVAFHNFNQFRAEGKVKLFGEYNGYAAGEQTRDFVSVEDVVKVNLFFFDNPDKSGIFNL
GSGRAQPFNDIASTVVNTLRSLNNEPSLSLADQVQRGLIEYIPFPDALRGKYQCFTQADL
TKLRAAGYDAPFLSVQEGVDRYVRWLFGQV