Protein Info for H281DRAFT_03912 in Paraburkholderia bryophila 376MFSha3.1

Annotation: competence protein ComEA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF12836: HHH_3" amino acids 21 to 78 (58 residues), 56.4 bits, see alignment E=5.5e-19 PF14520: HHH_5" amino acids 30 to 78 (49 residues), 18.5 bits, see alignment E=4.5e-07 amino acids 31 to 49 (19 residues), 17.5 bits, see alignment 9.6e-07 PF14579: HHH_6" amino acids 31 to 80 (50 residues), 33.8 bits, see alignment E=6.5e-12

Best Hits

KEGG orthology group: K02237, competence protein ComEA (inferred from 90% identity to bxe:Bxe_A0989)

Predicted SEED Role

"DNA uptake protein and related DNA-binding proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFB1 at UniProt or InterPro

Protein Sequence (121 amino acids)

>H281DRAFT_03912 competence protein ComEA (Paraburkholderia bryophila 376MFSha3.1)
MFRKILVTAAMLAAFGHAYASVDVNTANEDALRGIKGIGPAKAKAILEERSAHGPFKDPS
DLGKRVKGMGGHTVERLQAEGLAVGPAGAAAGSQVAASSQTKGATVPANTPKGGATVAVK
K