Protein Info for H281DRAFT_03910 in Paraburkholderia bryophila 376MFSha3.1

Annotation: membrane-bound lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13406: SLT_2" amino acids 75 to 383 (309 residues), 283.9 bits, see alignment E=7.2e-89 TIGR02282: lytic murein transglycosylase B" amino acids 80 to 385 (306 residues), 339.4 bits, see alignment E=7.9e-106

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 92% identity to bug:BC1001_2622)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ME85 at UniProt or InterPro

Protein Sequence (412 amino acids)

>H281DRAFT_03910 membrane-bound lytic murein transglycosylase B (Paraburkholderia bryophila 376MFSha3.1)
MTVKLALSARNRLSTRTIATALSIASCMFMATTPARAQIAGKKPPTLLAQAQPQTAVPQG
QTFEEEIIPQRYANNPNVDAFINDMVARYDFDESSLHSLFAGVSYSATAVKLVTPSASPS
VKNWRAYQSRFLDQIRINAGIRFWRANQATLQRAYEEFGVPPEVIVGILGVETIYGRFMG
NFRVLDALTTLSFDYPNTPNRADRQATFRKNLEDYLVWTRDSQIDPTTVLGSYTGAIGIP
QFLPSSITQYAVSYDGNKEIDLRTSQADAIGSVANYLRQNGWENGRPVVWKIGTDAGSLG
VAQAAADGAPEPHWPLDQLLRAGLLLNEPSVNIAAEAGTPVTVVDLPSPGRGTEYMLGLK
NFYVLTRYNRSFFYALAVYQLGERIKSQMQASDAASPGNAQNNAAPPSAASQ