Protein Info for H281DRAFT_03884 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details PF16576: HlyD_D23" amino acids 66 to 258 (193 residues), 48.3 bits, see alignment E=1.6e-16 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 67 to 249 (183 residues), 107.1 bits, see alignment E=4.5e-35 PF13533: Biotin_lipoyl_2" amino acids 67 to 114 (48 residues), 55.6 bits, see alignment 7e-19 PF13437: HlyD_3" amino acids 175 to 258 (84 residues), 41.6 bits, see alignment E=3.5e-14

Best Hits

Swiss-Prot: 39% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_4419)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>H281DRAFT_03884 RND family efflux transporter, MFP subunit (Paraburkholderia bryophila 376MFSha3.1)
MCWCWALSSSFRTDSFREINVKKTWFSVGQIVLTLIVVVAAALVLWKLVDYYMFAPWTRD
GHVRADVIQVAPDVSGLISSVQVLDNQQVRQGQVLFVIDQARYTLALRQAQATAQQRRAT
LDQARREDVRNRKLGNLVAAEVAEESRSRVDQAEAALADANVAIDTAKLNLQRATIMSPV
DGYLNDRAPRAGEFVAAGRAVVSVVDMHSFRVDGYFEETKLGGIDIGQPVDINVMGEPHL
LRGHVQSIVAGIEDRDRTQGSNLLPNVNPAFSWVRLAQRIPVRVALDEVPADFRMIAGRT
ATVSVRDLANARASHVTGASSASAATPASAAATSGASQ