Protein Info for H281DRAFT_03866 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, LysR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR02424: pca operon transcription factor PcaQ" amino acids 8 to 306 (299 residues), 381.7 bits, see alignment E=9.7e-119 PF00126: HTH_1" amino acids 12 to 71 (60 residues), 74.5 bits, see alignment E=5.1e-25 PF03466: LysR_substrate" amino acids 99 to 305 (207 residues), 127.2 bits, see alignment E=5.9e-41

Best Hits

KEGG orthology group: K02623, LysR family transcriptional regulator, pca operon transcriptional activator (inferred from 92% identity to bug:BC1001_5051)

Predicted SEED Role

"LysR family transcriptional regulator YdcI" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLS4 at UniProt or InterPro

Protein Sequence (332 amino acids)

>H281DRAFT_03866 transcriptional regulator, LysR family (Paraburkholderia bryophila 376MFSha3.1)
MQRSLADSRVKFRHLQCFLAVAQFGSVQRAADSLSITQPAVSKTVAELETILGVKLFERG
RHGAVPTREGQLFMPHASACVSALRQGVDLLARAEGAAAATLEVGILPTVAAALIPPVLK
RFASLWPRVIVRLATGANPELLERLKAGTIEFAIGRLADPERMVGLSFEQLFTEPLIAVV
RAGHPLDAAPGLPSAALQDFTVVLPPFGTLIRQSAESLLSAWGVPPLSAFVEVLSVSTGR
ALTLENDAVWFVPLSAVEYELAHGMLVRLPLPFAGTGEPVGLIRRSDTQPSAVGRAFIDA
VREVAQLRMAAGASRPAGNAAHKRARRTTPTT