Protein Info for H281DRAFT_03843 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Phenylpropionate dioxygenase, large terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF00355: Rieske" amino acids 27 to 107 (81 residues), 65.1 bits, see alignment E=4.3e-22 PF19301: LigXa_C" amino acids 157 to 418 (262 residues), 95.1 bits, see alignment E=4.8e-31

Best Hits

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_4039)

Predicted SEED Role

"InterPro IPR005806 COGs COG2146"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MNH0 at UniProt or InterPro

Protein Sequence (438 amino acids)

>H281DRAFT_03843 Phenylpropionate dioxygenase, large terminal subunit (Paraburkholderia bryophila 376MFSha3.1)
MMSSAQNDAITRVGKGTPAGELLRNYWQPVALVEELADVRPVRAVRLMGQDFVVFRDEQG
RYGMLDRDCPHRGADLAAGRLEAGGLRCAFHGWLFDVDGQCLSTPGEPVGSSLCKRVRQS
AYPVIERSGILFAYIGKGEPPAFPHFDCFAAPNEYTFAFKGLFECNWLQALEVGIDPAHA
SFLHRFFEDEDVSASYGKQFRGASADSNMPITKVLREYESPEILVSPADYGLRLIAKRPI
DDEHTHVRVTNVVFPQAFVIPMSAEMTITQWHVPVDDENCYWYAIFTSFGAPTNKQQMRE
QRLELYELPDYISRRNKRNQYGFNVHEQLTETYTGMGFDINVHDQWAVESQGPIQDRTRE
HLGTTDKGIIAYRRLLVDAIEKTQAGEKTLMVIDAEAAAHLTGPASIDGIAPAERWDEYW
KEADASRRAAAPWPAPKV