Protein Info for H281DRAFT_03802 in Paraburkholderia bryophila 376MFSha3.1

Annotation: two-component system, OmpR family, sensor histidine kinase TctE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 167 to 186 (20 residues), see Phobius details PF08521: 2CSK_N" amino acids 17 to 159 (143 residues), 113.1 bits, see alignment E=2.2e-36 PF00512: HisKA" amino acids 236 to 301 (66 residues), 44.6 bits, see alignment E=2.5e-15 PF02518: HATPase_c" amino acids 352 to 455 (104 residues), 93.2 bits, see alignment E=3e-30

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 91% identity to bug:BC1001_4565)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLV9 at UniProt or InterPro

Protein Sequence (464 amino acids)

>H281DRAFT_03802 two-component system, OmpR family, sensor histidine kinase TctE (Paraburkholderia bryophila 376MFSha3.1)
MTNSLRVRLLWWLLVPLALYVFVTGKAEYDNARRTADLVQDNQLISSARMIAGAVEWVDG
FLRVDVPPAALEIFASPYRDQVFYSVNVDDRQLLAGTPEFPPRPAQAADTPDHYDTALYG
QNVRAVGLVRLMYDNGATRHVRVTVGKTVRSRDAMAEQLWRPQLVRQIEMIALAVALVCI
GLTFELRPLMKVKDEVADRDPMQLEPIRVDRLHTELRPIVEAINQCIARLGVQVAAQRRF
IADAAHQLRTPLTLLGTQLQFARQQGGVNPALDEALAAMHRSNRSMVGLTNKLLLLAQAE
AADNRQVIVETVDLVPLAMEVVEDFALLAQGRQIDLGAELCDIAPVAGHRGLLQALIANL
AENAIRYTGSGGHVTVAVTADAHRVTVSVIDDGPGIPAESRSRIFEPFFRASTDTEGTGL
GLAIVREIADAHKGDIVLQAGEGGKGVHIAVSFPRAASGQSRAG