Protein Info for H281DRAFT_03768 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted arabinose efflux permease, MFS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 209 (182 residues), 45.1 bits, see alignment E=6.6e-16 PF06779: MFS_4" amino acids 31 to 394 (364 residues), 254 bits, see alignment E=3e-79

Best Hits

KEGG orthology group: None (inferred from 91% identity to bgf:BC1003_4894)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>H281DRAFT_03768 Predicted arabinose efflux permease, MFS family (Paraburkholderia bryophila 376MFSha3.1)
MSSAPSLTSPGSTSLDARSLYATLAGLCGSLVAIGLARFAYTPLIPSLIQAHWFTSSQAV
TLGAANFAGYLIGALIGRPLASALSNRTALRLLMAVVTAAFFACAYPLSISWFFAWRLLS
GISGGAIMVLVATSILPHIPAARRGFVSGMIFLGLGLGIAASGTLIPELLHFGLRTTWLG
LGAVALALTAVSWFGWPSTNPPAPVAAAGNRHASHASNLGLRVLYAQYAANALGLVPAMI
LLVDYVARGLGRGAAIGADYWVLYGLAAIVGPVIAGNVAHRIGYGKAYRVALLLQAVAVA
MLALSGNAWVLGLSTVILGVFTPGIVPLALGRIHELVPHDHTEQRASWSRATTAFALFQA
LGGYGYSYLFSHSHNNYALIFACGAVALALAFIADIVASRVRTAPATGM