Protein Info for H281DRAFT_03762 in Paraburkholderia bryophila 376MFSha3.1

Annotation: TRAP transporter, DctM subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 207 to 246 (40 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 374 to 398 (25 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details amino acids 443 to 463 (21 residues), see Phobius details amino acids 475 to 499 (25 residues), see Phobius details amino acids 518 to 557 (40 residues), see Phobius details amino acids 563 to 587 (25 residues), see Phobius details amino acids 603 to 624 (22 residues), see Phobius details PF04290: DctQ" amino acids 48 to 174 (127 residues), 96.4 bits, see alignment E=1.3e-31 PF06808: DctM" amino acids 215 to 623 (409 residues), 353.1 bits, see alignment E=2e-109 TIGR00786: TRAP transporter, DctM subunit" amino acids 224 to 625 (402 residues), 303.7 bits, see alignment E=9e-95

Best Hits

KEGG orthology group: None (inferred from 92% identity to bxe:Bxe_B0439)

Predicted SEED Role

"Predicted gluconate TRAP family transporter, DctM subunit" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (628 amino acids)

>H281DRAFT_03762 TRAP transporter, DctM subunit (Paraburkholderia bryophila 376MFSha3.1)
MSNHALNAAQAAVPLPTVSTPRRWLKVLDRGLISVVEVCAALLLAVEIVVMLAGVVSRYA
LHQPLVWSDELAGILFLWLAMLGAVLALRRGEHMRMTVLVSRLSTERRAFVDTLAIAASV
ALLALLVAPAYNYASGEAAIVTPALQISNAWRAFALPIGAALMLVVGLIRLAQTSRMRDV
VIALAIAALLGAAAIWAGPWFQTLGKANLIIFFVGVVAIGIFSGVPIGFSFALATFGYLG
LSTFTPLEVVVGRMDEGMSHLVLLAVPLFVFLGLLIEMTGMARAMIQFLASLVGHVRGGL
SFVLIGAMYLVSGISGSKVADMAAIAPVLFPEMKKRGASEGDLVALLATTGAQSETIPPS
IVLITIGSVTGLSISALFTAGMLPGAVLALILCVVVWWRYRKEDLSGTQRFSKRQIGRLF
IVSLPALALPFVIRAAVVEGVATATEVSTIGIAYSMLIGLLIYRRFEWRRLPRMLVDAAT
LSGAILFIIGCATAMAWALTQSGFSQDLAQWMGAMPGGAYGFLAVSIVVFVMLGSVLEGI
PAIVLFGPLLFPIARLAGVHEVHYAIVVILSMGVGLFSPPFGVGYYSACAISKVSPDAGI
RPIVGYMGALIVGLIVVAAIPWISTGFL