Protein Info for H281DRAFT_03747 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter substrate-binding protein, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF01547: SBP_bac_1" amino acids 45 to 324 (280 residues), 183.6 bits, see alignment E=9.3e-58 PF13416: SBP_bac_8" amino acids 49 to 349 (301 residues), 140.2 bits, see alignment E=1.2e-44

Best Hits

Swiss-Prot: 58% identical to Y2784_BRUAB: Putative binding protein BruAb2_0484 (BruAb2_0484) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 98% identity to bgf:BC1003_4878)

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLH7 at UniProt or InterPro

Protein Sequence (410 amino acids)

>H281DRAFT_03747 carbohydrate ABC transporter substrate-binding protein, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
MSLHARASLALGKVAVALAFAGIAVAAHADTVRVTVAHYSDATAPYFEKMARNFEKANPG
TTIKIEDVNWDTLQQKLQTDISGNANADLAIVGTRWLLDFVKDDVAEPLDGYMDASFKGR
FIGPFLAPGEINGKVYGLPIAASARALYYNKDLLAKVGYPDGPKTWNDVIEASKKLKAQG
IAGFGLQGKEIETDVYFYYVLWTNGGEVIGKDNKAAFNSPAGIKAATLYKSMIDQGLTQP
GVTGYSREDVQNLFKQGRVAMMISAPFLAKQIKKEAPNLKYGIDPIPMGTTHATYAVTDS
IVMFKNSKVKKSAWKFLDYLFTKEPRVEFTTTEGFLPTTKAESSDPAFNDPDTKAFVALL
PTARFAPTVTGWEDTAKAVTDAMQSIYLGKAKPADALNAAATQANKSLGH