Protein Info for H281DRAFT_03746 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter membrane protein 1, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 289 (202 residues), 60.7 bits, see alignment E=8.3e-21

Best Hits

Swiss-Prot: 59% identical to Y3749_BRUSU: Probable ABC transporter permease protein BRA0749/BS1330_II0742 (BRA0749) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 98% identity to bug:BC1001_4620)

Predicted SEED Role

"ABC sugar transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLS8 at UniProt or InterPro

Protein Sequence (296 amino acids)

>H281DRAFT_03746 carbohydrate ABC transporter membrane protein 1, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
MSRSASSRLQAPWLLIAPSLVLALFIISYPIFNIVWQSLHEVSRFGAIRDFTGLQNFYTI
FGDPAFLAAARRTIVWTVFVVGGTVLISVPVALVLNQDFYGRGVARTIVMLPWSVSLTMT
AVVWRWAFNDDYGMVNVTLQRLGLIGGPIHWLATPEFAFPVEIAVGILVSIPFTVTILLG
GLSSVPGDIYEAARIDGASAWQQFRKLTLPLLRPFINMTILLNVIYVFNSFPIIWVMTQG
GPDNSTHILVTYLYELGFRLGRPGEAAAVSLIMLVMLFVFSMAYLRLQPAKEGEPS