Protein Info for H281DRAFT_03703 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NADP-dependent 3-hydroxy acid dehydrogenase YdfG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF13241: NAD_binding_7" amino acids 8 to 98 (91 residues), 23.8 bits, see alignment E=2e-08 PF00106: adh_short" amino acids 11 to 196 (186 residues), 207.8 bits, see alignment E=4.1e-65 PF01370: Epimerase" amino acids 14 to 126 (113 residues), 30.2 bits, see alignment E=1.1e-10 PF08659: KR" amino acids 14 to 160 (147 residues), 44.2 bits, see alignment E=7.4e-15 PF13460: NAD_binding_10" amino acids 17 to 139 (123 residues), 27.3 bits, see alignment E=1.1e-09 PF13561: adh_short_C2" amino acids 20 to 254 (235 residues), 189.5 bits, see alignment E=2.6e-59

Best Hits

KEGG orthology group: None (inferred from 93% identity to bgf:BC1003_4835)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MNE8 at UniProt or InterPro

Protein Sequence (257 amino acids)

>H281DRAFT_03703 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (Paraburkholderia bryophila 376MFSha3.1)
VNSIQSPLAGQHAVVTGGGSGIGAAIAEALLHAGARVTLMGRNSERLAAQREKCRAWGDV
ACITVDVTQEESVAKAFNEAGAVDILINNAGQAQAAPFTHTDMTLWQRMLDVNLTGVFLG
TRAVLPGMLERRHGRIVNVASTAGQIGYAYVAAYCAAKHGVIGLTRSLALEVATKGVTVN
AVCPGYTETELLHASLQQITSKTSRTEEQARESLLRSNPQHRFVSPEQVANAVLWLCQPG
SDAITGQSVSISGGEVM