Protein Info for H281DRAFT_03682 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF03547: Mem_trans" amino acids 6 to 306 (301 residues), 123.6 bits, see alignment E=3.7e-40

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 93% identity to bgf:BC1003_4811)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLS7 at UniProt or InterPro

Protein Sequence (314 amino acids)

>H281DRAFT_03682 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MLATLEILLPVFGLIFAGFACRRRGVLGPNSASELNRFVVWLALPALLFDTMARATWEQL
YQPAFVVTFSIACAGIFAVILVMRLLSGRHLADASVDAIAASYPNTGYIGFPLGMIAFGQ
ASLTPTTIATILVACVLFAGAIVLIEIGLQTERTPHKLGLKVLRSLARNPLIVSPIAGAL
FAGLHVAMPPSAETFLKLLSGAASPCALVSLGLFLAERRPSESGTRGIALLLTLVKLVVQ
PALTWWLASRVFRLSPALVEMAVVLAALPTGTGPFMLAEFYEREAQITSRTILLSTVGSV
VTLSLLLLWMGHRT