Protein Info for H281DRAFT_03643 in Paraburkholderia bryophila 376MFSha3.1

Annotation: aspartate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF03447: NAD_binding_3" amino acids 19 to 127 (109 residues), 52.6 bits, see alignment E=7.4e-18 PF01958: Asp_DH_C" amino acids 178 to 264 (87 residues), 123.2 bits, see alignment E=4.2e-40

Best Hits

Swiss-Prot: 80% identical to ASPD_BURL3: Probable L-aspartate dehydrogenase (nadX) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K06989, aspartate dehydrogenase [EC: 1.4.1.21] (inferred from 96% identity to bxe:Bxe_B0182)

Predicted SEED Role

"Aspartate dehydrogenase homolog"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLG1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>H281DRAFT_03643 aspartate dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MREAGYAGHHAPVDVAMIGFGAIGQAVYRSVAADPTVRVSHVIVPERHMNSVREVVGSTV
DVVASVSALSSRPHFALECAGHSALVDHVVPLLKAGTDCAVASIGALSDVMLLDALSAAA
DEGDATLTLLSGAIGGVDALAAAKLGGLDEVLYTGRKPPTGWLGTPAEQVCDLNTLMEEK
VIFEGSAREAARLYPKNANVAATIALAGLGLDHTTVRLIADPNVTRNVHRILARGAFGEM
SLEMCGKPLPDNPKTSALTAYSAIRALRNRAARCVI