Protein Info for H281DRAFT_03637 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 13 to 204 (192 residues), 179.9 bits, see alignment E=8.3e-57 PF01370: Epimerase" amino acids 14 to 181 (168 residues), 21.4 bits, see alignment E=3.1e-08 PF08659: KR" amino acids 14 to 174 (161 residues), 51.8 bits, see alignment E=2e-17 PF13561: adh_short_C2" amino acids 19 to 252 (234 residues), 193.1 bits, see alignment E=1.2e-60

Best Hits

Swiss-Prot: 40% identical to HSD_MYCBO: 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase (fabG3) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 95% identity to bpy:Bphyt_7060)

MetaCyc: 32% identical to 7alpha-hydroxysteroid dehydrogenase (Stenotrophomonas maltophilia)
7-alpha-hydroxysteroid dehydrogenase. [EC: 1.1.1.159]; 1.1.1.159 [EC: 1.1.1.159]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.159

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MN03 at UniProt or InterPro

Protein Sequence (255 amino acids)

>H281DRAFT_03637 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (Paraburkholderia bryophila 376MFSha3.1)
MHKDASATLNGRRVLVTGGARGLGAAFVRALVQAGAQVVFGDVLHEEGRALAASLAGQGH
AAIYLPLDLADPESIKQFAEQGASRLGGIDALINNAAITNSGGKFADELSVDTWDAVMNV
NVRGTWLMSTAVLPYLRDSGRGSIVNIASDTAMWGAPKLLAYVASKGAVISMTRSLAREF
GAHQVTVNAIAPGLTEVEATAYVPAERHEYYLQGRALTRAQVPDDVTGPVLFLLSDAARF
VTGQLLPVNGGFVMN