Protein Info for H281DRAFT_03570 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 397 (364 residues), 152.3 bits, see alignment E=8.5e-49 amino acids 287 to 436 (150 residues), 48.9 bits, see alignment E=2.4e-17

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_4797)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MNC4 at UniProt or InterPro

Protein Sequence (443 amino acids)

>H281DRAFT_03570 Sugar phosphate permease (Paraburkholderia bryophila 376MFSha3.1)
MSDLGAIATGGREQSADGAAAIIRKVAWRLMPLIMICYLFAFFDRINISFAKFQLQSDLG
LSDTAYGLGASLFVIGYVLFEVPSNLFLYKVGARRWIARIMISWGLATAAMVFVNTEWQF
YGLRFLIGAMEAGFAPGVLYYLTLWFPPSYRGRITSMLFLASAFSGLVGAPLAGLVIGHM
NGVLGMPGWHWLFLLGGLPCVLLGYLVLKLLKDRIEDANWLSPAEKSYLSEQIAQQSRHP
DTGHSLLGAIRTPGFLTLGLVYFLIQVASYGLNFWTPHLIRVAGTHNPTLIGLLTAVPYV
CGAICMVVVGRLSDATGERRKFVFGLLVMSAIGFFAAGFFDKQTGFLIVALAVMGAGVVA
SIPAFWALPPKLVTGAGAAGGIALINTLGQLGGIVSPIMVGRVRDLTGSTTPALYVIGTM
SVICALIVLRGLPESLRRKDGVR