Protein Info for H281DRAFT_03561 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Threonine/homoserine efflux transporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 20 (1 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 134 (128 residues), 79.2 bits, see alignment E=1.6e-26 amino acids 150 to 283 (134 residues), 42.3 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_4688)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKZ6 at UniProt or InterPro

Protein Sequence (298 amino acids)

>H281DRAFT_03561 Threonine/homoserine efflux transporter RhtA (Paraburkholderia bryophila 376MFSha3.1)
MNLSLYAVTVLIWGTTWIAIKWQLGEVPPPVSIAWRFWIAALVLFALLRIMRRPMWPPRA
AWRFLFAQGLALFCVNFLCFYYAEQVVPSGLVAVVFSTAPLLNSINGRLFMGRPLQPSAI
AGAMLGLVGIVCLFVQQMSGHLGDHAAWLGLGIAFLGTLCFSAGNLLSSRMQSMGLHPFA
TNSWAMLIGASVLTVGSALAGFPFAIESSTRYLGALAYLAVFGSVIGFTAYLMLVGRIGP
ERAAYSTVLFPIVALAVSTVFEGYQWSALAVVGLLLVVAGNLVAFDMTRRIFGRRSHA