Protein Info for H281DRAFT_03555 in Paraburkholderia bryophila 376MFSha3.1

Annotation: thioredoxin reductase (NADPH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 PF00027: cNMP_binding" amino acids 50 to 133 (84 residues), 55.6 bits, see alignment E=1.8e-18 PF07992: Pyr_redox_2" amino acids 246 to 548 (303 residues), 120.5 bits, see alignment E=3.8e-38 PF00890: FAD_binding_2" amino acids 247 to 286 (40 residues), 23.9 bits, see alignment 9.1e-09 PF01266: DAO" amino acids 247 to 288 (42 residues), 32 bits, see alignment 3.9e-11 PF13450: NAD_binding_8" amino acids 250 to 284 (35 residues), 25.4 bits, see alignment (E = 5.8e-09) PF13738: Pyr_redox_3" amino acids 313 to 531 (219 residues), 43.4 bits, see alignment E=1.1e-14 PF00070: Pyr_redox" amino acids 391 to 465 (75 residues), 27.9 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 93% identity to bug:BC1001_4812)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKT1 at UniProt or InterPro

Protein Sequence (571 amino acids)

>H281DRAFT_03555 thioredoxin reductase (NADPH) (Paraburkholderia bryophila 376MFSha3.1)
MLSVSEPETQSEAVVADAPFSNLSTRMHQMFPALTEAEIDRVRRFGEPSHWEAGELLFET
GHTGPGMFVLLEGRVKVYQRDGIGREVVIGEHGPGHFLAEVGQLSGRHALVNGMALSAVR
ALLIPPEKLRALLVAEAELGERIMRALILRRVSLIEKGAGGPILIGSSTDARLVMLQGFL
SRNGHPHSTIDECDEDALRLVEQFGAQQEDMPLVICPDGSVLRHPSMPELATSLGLLPDL
DASLVYDVAIVGAGPAGLATAVYAASEGLSVIVLDSRAPGGQAGASSRIENYLGFPTGIS
GQALAGRAFVQAQKFGAHVAIPVHVKALHCGEAPYRLELKCGGHISARTIVIASGAVYRR
PALEGLDRFDGRGVYYWASPVEAKLCKRQEVVLVGGGNSAGQAIVYLATHAAKVHVLIRR
SGFEATMSRYLIDRIRSLPNVVVHPNSEIGRLVADESGLASVALKKPLPDGTDHIDTRHL
FLFTGADPNTDWLRTCGVELDEKGFVLTGTSADGVSACDLATTVKGVYAIGDARAGSTKR
VAAAVGEGAAVVAQIHQILAVSADEAVASVA