Protein Info for H281DRAFT_03554 in Paraburkholderia bryophila 376MFSha3.1

Annotation: membrane protein DedA, SNARE-associated domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details PF09335: SNARE_assoc" amino acids 28 to 156 (129 residues), 47.3 bits, see alignment E=2.9e-16 PF00581: Rhodanese" amino acids 210 to 304 (95 residues), 37.8 bits, see alignment E=2.3e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_4682)

Predicted SEED Role

"Alkaline phosphatase like protein" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMG6 at UniProt or InterPro

Protein Sequence (330 amino acids)

>H281DRAFT_03554 membrane protein DedA, SNARE-associated domain (Paraburkholderia bryophila 376MFSha3.1)
MLHDLVEQYGPALIFANVLAASIGLPVPAMPSLVLFGAMAAMHPGSVGTQLLPVLVLSIF
ATLIGDSAWYLAGRLYGGNTLKTICRLSLSRDTCVKKTERFFGRWGVRVLAVAKFVPGLS
IVSIPMAGAMGTRYRTFLTYDSIGAALWSGTGLIVGALFAHQIDMVFAAAGRLGRTAGVV
AIALLLLYAAYRWIRRRQLINKLASARIEVDELATLVEAGKTPVLFDIRSHEKRKLDPFV
IPGSQFADERQLDQIVATYPRDQKLVIYCSCPNEISAAWMAKQLNEAGFDDVLPLRGGME
AWRDSGRPVEALPGMPPPEAAVEHIAPKAV