Protein Info for H281DRAFT_03530 in Paraburkholderia bryophila 376MFSha3.1

Annotation: L-fuconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 80 to 98 (19 residues), see Phobius details PF04909: Amidohydro_2" amino acids 7 to 280 (274 residues), 197.4 bits, see alignment E=2.2e-62

Best Hits

KEGG orthology group: K07046, (no description) (inferred from 95% identity to bgf:BC1003_4657)

Predicted SEED Role

"L-fuconolactone hydrolase" in subsystem L-fucose utilization temp

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ML70 at UniProt or InterPro

Protein Sequence (280 amino acids)

>H281DRAFT_03530 L-fuconolactonase (Paraburkholderia bryophila 376MFSha3.1)
MNVKMHIDAHQHYWDPARGDYEWLTPELEILYRPFGPADLKPLRERAGIERTVVVQAAPT
IDETRYLLGIAREEPSIAGVVGWVPLLLPTAPALIGALAQEPKFKGVRPMLQDLPDDAWI
ANPDLAPAVEALIAHDLAFDALIYARHVDHVETFARRFPSLRIVVDHGAKPPIRYGQAGW
QTWADAIARLAKLPGVHCKLSGLATEASPGWTEETLRPYVEHLLATFGPARLMWGSDWPV
LELNGDYLLWHSVANTLLASLDDGEREAVFGGNAAAFYRL