Protein Info for H281DRAFT_03505 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative phosphonoacetaldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03250: putative phosphonoacetaldehyde dehydrogenase
  • amino acids 11 to 482 (472 residues), 870.1 bits, E=1.8e-266
• PF00171: Aldedh
  • amino acids 27 to 477 (451 residues), 472.8 bits, E=5e-146

Best Hits

Swiss-Prot: 59% identical to PHNY_RHIME: Phosphonoacetaldehyde dehydrogenase (phnY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00155, [EC: 1.2.1.-] (inferred from 92% identity to bxe:Bxe_B1869)

MetaCyc: 59% identical to phosphonoacetaldehyde dehydrogenase (Sinorhizobium meliloti 1021)
1.2.1.-

Predicted SEED Role

"NAD-dependent aldehyde dehydrogenases"

MetaCyc Pathways

• 2-aminoethylphosphonate degradation II (2/2 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.-

Sequence Analysis Tools

See A0A2Z5MJ92 at UniProt or InterPro

Protein Sequence (483 amino acids)

>H281DRAFT_03505 putative phosphonoacetaldehyde dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MNATLRDHPAFRAEALRLEGERAARPRSLDVVDPYTGTRVGTVALASVDDVRAAFEYAAA
YQAKLTRYERSQILERAAALSRDRTEEASDLISLESGLSKQDSRYEIGRVADVFRFAAIE
ALRDDGQSFSCDLTPHGKRRRVFSQREPLAGVIVAITPFNHPMNQVAHKVAPAIATNNRV
VLKPSEKVPLSALYLADILYEAGLPAPMLQVLTGDPREIADELITHPLAELVSFTGGVAI
GKYIAAKAAYRRVVLELGGNDPLIVLEDADLERAATLAVHGSYKNSGQRCTAVKRMLVQK
RVAADFADLVVEKTRAWTFGDPFDAANQMGTVIDVAAAQLFEARVNEAIAGGARLLIGNR
RNGALYSPTVLDGVEPDMTLVREETFGPVSPIISFDTLDDAIRISNGTCFGLSSGVCTNR
QDAITRFINELRVGTVNVWEVPGYRTELTPFGGIKDSGLGYKEGVQEAMKSFTNLKTFSL
PWE