Protein Info for H281DRAFT_03493 in Paraburkholderia bryophila 376MFSha3.1

Annotation: TIGR03118 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03118: TIGR03118 family protein" amino acids 40 to 363 (324 residues), 367.8 bits, see alignment E=2.3e-114

Best Hits

KEGG orthology group: None (inferred from 83% identity to bph:Bphy_5305)

Predicted SEED Role

"conserved hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MH86 at UniProt or InterPro

Protein Sequence (390 amino acids)

>H281DRAFT_03493 TIGR03118 family protein (Paraburkholderia bryophila 376MFSha3.1)
MKSLLAAFTVVACSAAIATLASCGGSSSSPSSGPPAQSSFTAKALVSDGAVSAAHTDVNL
KNAWGVAFNPKGFVWVADNGTNLATLYDGNGVPQSLVVTIPDGKNGTASPTGIVFNGTQS
FNVTQNGKSGVAAFIFVGEGGTVTAWAPAVGPTNAFVMYDDGTGGAVYKGLALAANNGNN
FLYAADFHNNKIDVFDTNFAKVAMPGAFTDPAIPAGFAPFGIQLIGSNLFVTYAKQDADK
HDDVAGAGLGMVDVFDTAGNLKQHFATGGALNAPWGITQAPSNFGSLSGAILIGNFGDGT
INAFNASSGQSMGAIKSSNGSAIVEPGLWGIAFGNGLNNQPATTLFFAAGPNDEADGVYG
RIDLNPASTSSSATGTSTGTSSSGGSSIGM