Protein Info for H281DRAFT_03486 in Paraburkholderia bryophila 376MFSha3.1

Annotation: osmoprotectant transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 58 to 223 (166 residues), 86.1 bits, see alignment E=1.3e-28

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 72% identity to vei:Veis_2246)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>H281DRAFT_03486 osmoprotectant transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MNTLLSRCALLFACAAPLQARADNWLLSIAQYRTDIVYQSITQMTMVAIAGGLAIVVAVP
LGIYLSRESGKHARAGQALLQTLNMGQAVPKLALLALAMSVLGIGRWPSIFALWVATLLP
IVLNTLEGLRAVPRALIEAATGMGMTPRQVLFRVELPNALYVIFAGIRTALAITVGTAPL
AFLVGGGGLGELIFTGIDMNDFSMLLAGAIPTAVLAVLTDVLIGQMQVHLVSRGVTPQR