Protein Info for H281DRAFT_03480 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 4-hydroxybenzoate polyprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details amino acids 453 to 472 (20 residues), see Phobius details PF01040: UbiA" amino acids 223 to 441 (219 residues), 67.3 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: None (inferred from 89% identity to bug:BC1001_3893)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>H281DRAFT_03480 4-hydroxybenzoate polyprenyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MAEASVPLCVDLDGTLTSTDLLVESFLVLVKRNPLYAFLCIGWLLRGKAHLKAQIAQRAA
IDVTLLPYNARLVEFLREERSYGRDLYLCTAANRKFAEEIASYFGFFKGILASTDAHNLS
GVHKAYALSEEFGPHGFDYCGNALCDVPVWKQCRRAIVVGTRQIAEAAERVNHKVLFFED
RRSLIALTVREMRVYQWVKNLLIFVPLLASHRFTEADTLQAEVIAFFSFCFCASSVYLLN
DMLDLDADRRHVHKRDRPFASGQLSLAFGMLLGCVLLIASAGFALLLPFTFQLVLAGYFA
TTLAYSLRLKRFMLVDVFVLAALYTARVVAGGAAGDIPLSDWLIMFSILIFLSLAMVKRY
AELDALLREAKVCAVGRGYVTQDLGILRSFGTASGYVAVLVLALYMNSSDVRVLYRHPHA
LWFLFGLLLFWISRVWMLAFRGEMHDDPIVFTIKNRLSLLVVFLCVATVIAAS