Protein Info for H281DRAFT_03466 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 57 to 77 (21 residues), see Phobius details PF13412: HTH_24" amino acids 5 to 51 (47 residues), 73.5 bits, see alignment E=1.2e-24 PF13404: HTH_AsnC-type" amino acids 5 to 46 (42 residues), 70.9 bits, see alignment E=9.4e-24 PF01037: AsnC_trans_reg" amino acids 79 to 145 (67 residues), 74.3 bits, see alignment E=8.6e-25

Best Hits

Swiss-Prot: 39% identical to BKDR_PSEAE: Bkd operon transcriptional regulator (bkdR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 97% identity to bug:BC1001_5477)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGR7 at UniProt or InterPro

Protein Sequence (155 amino acids)

>H281DRAFT_03466 transcriptional regulator, AsnC family (Paraburkholderia bryophila 376MFSha3.1)
MSTDLDKTDRAILAALQKDGRMSNAKLAELVGLSETPCARRLKRLENDGYIGQYRAVLAR
SALGFGVVAFILVRFAVHDKDLANRFEREVQAIPRVIACHNVSGSADYILQVVARDLDDY
GSFMRDQMRSLPGVTSVESALSLREVKADGGLPLS