Protein Info for H281DRAFT_03455 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 2-haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR01428: haloacid dehalogenase, type II" amino acids 10 to 205 (196 residues), 142.4 bits, see alignment E=2.8e-45 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 12 to 191 (180 residues), 43.1 bits, see alignment E=7.8e-15 PF00702: Hydrolase" amino acids 12 to 180 (169 residues), 60.7 bits, see alignment E=4e-20 PF13419: HAD_2" amino acids 14 to 201 (188 residues), 54.8 bits, see alignment E=2.1e-18 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 106 to 182 (77 residues), 27.1 bits, see alignment E=7.3e-10 PF13242: Hydrolase_like" amino acids 157 to 223 (67 residues), 23.6 bits, see alignment E=5.9e-09

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 89% identity to bug:BC1001_5460)

Predicted SEED Role

"HAD superfamily hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>H281DRAFT_03455 2-haloacid dehalogenase (Paraburkholderia bryophila 376MFSha3.1)
MSLHNTARPRWLTFDCYGTLIQWDEGLQAAVREILETKHGHDVDPARLIAVYDRHEHRLE
QTAPHRSFREVAGAGLHLALTELGLPADERDVRTLTDRISAMPPFPEVVDTLQRLKEDGY
RLCIVSNTDDDVIAGNVAQLGGHIDRVITAQQAGAYKPARRLFDYAHEQLGVTRDEVVHI
CASPHLDHAAARDIGFRCVWIDRATGRTLLPDYRPDATLSTLDQVPPLFASLGW