Protein Info for H281DRAFT_03441 in Paraburkholderia bryophila 376MFSha3.1

Annotation: O-antigen ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 198 (31 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 354 to 369 (16 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details PF04932: Wzy_C" amino acids 172 to 325 (154 residues), 72.1 bits, see alignment E=2.3e-24

Best Hits

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_3967)

Predicted SEED Role

"O-antigen polymerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MI68 at UniProt or InterPro

Protein Sequence (415 amino acids)

>H281DRAFT_03441 O-antigen ligase (Paraburkholderia bryophila 376MFSha3.1)
MAYISLLALFLTVTNLVPLSAVGFVPIVLYSWRFFGRRYPAFITPLTALTAFIVVSTLLY
DPKSFTEFEFYRRDGNFFISYAPIFAGCLYVHRLDLNKVLRTFFIFAVGINIPPYAYYVV
ETGILSIFTNPDNSFGSYFIARNAAGGFFAMLFCLGVGCYLQKRSKLLLALIAANAMMLF
STYSRGSLLGAAAVLPYLYFGRKRWLLAVLMGGLIAGSLAMAFFHTDGTIDYMGYPFNIH
NQDAKVANLNIRYEWLWPRALAYFEQSPIVGLGFGSFDDHIGTVTSYFHLFGAPSDIVVE
HSDSHAHNSYLNALAETGVVGLFLTLTFFWKLVEWSKDGAAASALVGGGQNFSAFRFVEI
SSVCLLVMAATEHRLVSPSNVLILSLVISLLLASQSANAITAEFNRRKSLARRRV