Protein Info for H281DRAFT_03415 in Paraburkholderia bryophila 376MFSha3.1

Annotation: polyphosphate kinase 2, PA0141 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF03976: PPK2" amino acids 17 to 241 (225 residues), 307.2 bits, see alignment E=3.6e-96 TIGR03707: polyphosphate kinase 2" amino acids 17 to 244 (228 residues), 350 bits, see alignment E=3.2e-109

Best Hits

Swiss-Prot: 60% identical to PK21C_RHIME: Polyphosphate:ADP phosphotransferase 3 (SMa0670) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 79% identity to bge:BC1002_5528)

Predicted SEED Role

"FIG00464652: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>H281DRAFT_03415 polyphosphate kinase 2, PA0141 family (Paraburkholderia bryophila 376MFSha3.1)
MTKHQCKQDDPVKRETLSNKEYLRELTPMQVELVKLQEWVVQTGQKICIVFEGRDGAGKG
GTIKAITERVSPRVFRVVALPAPTDREKSQMYVQRYLPHLPAAGEIVIFDRSWYNRAGVE
RVMGFCTENEAVSFLKAVPLVERAIVHSGIILLKYWLEVSEEEQTRRLQARITDGRKVWK
LSGMDLKSYSRWYDYSRARDAMFEASDTDFAPWFVAVSNDKRRARLNIISDLLQKIPYKT
IAREKVTLPARQKPNGYKEPDYPFKYVAERF