Protein Info for H281DRAFT_03413 in Paraburkholderia bryophila 376MFSha3.1

Annotation: high affinity sulphate transporter 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 68 to 84 (17 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 223 to 249 (27 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 366 to 383 (18 residues), see Phobius details amino acids 403 to 430 (28 residues), see Phobius details TIGR00815: sulfate permease" amino acids 26 to 564 (539 residues), 413.1 bits, see alignment E=8.4e-128 PF00916: Sulfate_transp" amino acids 38 to 404 (367 residues), 346.4 bits, see alignment E=1.8e-107 PF01740: STAS" amino acids 459 to 554 (96 residues), 46.8 bits, see alignment E=2.3e-16

Best Hits

KEGG orthology group: None (inferred from 77% identity to bge:BC1002_5551)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>H281DRAFT_03413 high affinity sulphate transporter 1 (Paraburkholderia bryophila 376MFSha3.1)
VTNKVRAAGRATDAAAPSGWRSVFPPAQWLASYQPKWLKKDAIAGVTLAAYGIPVSLAYA
SLAGLPPQYGIYCYLVGGVCYALFGSSRQLAIGPTSAISMLVGLTIAGMADGDPARWASI
AALTALLIAGMCCIAWLLRLSSLVNFISETILVGFKAGAALTIALTQLPKLLGTKGGGES
FFERLIVLGGQIPTTSLTVLIFGLVCIAVLVLGEKYLPGRPVALAVVIVSTIIVSVTSLA
AHGFSVVGALPRGLPEFHLPTLRVRDVDGIVSLAFACLLLSYVESVSAARALAQAHGYEI
DARQELLGLGAANLAAGLFQGYPVAGGLSQSSVNDKAGARTPLALVFASLTIALCLMFLT
ELLRNLPTVVLAAIVMVAVKGLVDVKEIRHLWRVSRYEFAVSFVAFAAVLMLGILKGVIV
AVLVSMLLIIRRAARPHVAFLGRIRGTRRFSDIQRHADNESIAHVLVFRVAASLLYFNIE
HVRQTVWAKVHEVSEPIKLVICDLSTSPVVDLSGARMLAALHGALQAKGIDLRIVGAHAE
ARDILRAENLEARVGPIGRRYSVADVVDEFESGRAADSKDPHRDTEQAVKTVVSKPD