Protein Info for H281DRAFT_03390 in Paraburkholderia bryophila 376MFSha3.1

Annotation: H+/Cl- antiporter ClcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 353 to 380 (28 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details PF00654: Voltage_CLC" amino acids 77 to 404 (328 residues), 233.6 bits, see alignment E=1.9e-73

Best Hits

KEGG orthology group: None (inferred from 64% identity to bxe:Bxe_A2770)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>H281DRAFT_03390 H+/Cl- antiporter ClcA (Paraburkholderia bryophila 376MFSha3.1)
MGHSLRWAAVVVLIGIAGGVAGLGLAALLHTVQHVAYGYSVETIFSKESFQQGVTAASRS
RRVEMLALCGLVAGVGWWAVYRWCKPLVSIARAVRSDDPRMPVFATVCHALLQIVTVALG
SPLGREVAPREIGAMLAGRLTSFAGLTVAESRIMVACGAGAGLAAVYNVPVAGAVYVLEG
LLFTIGWRAVVPAVVTSAIAGLIARAGLGDFPQYDVPHYACTASLIVWSALAGPLIGLAA
WQFTKLTDHARARAPRDSRLVLLCAVNFLCIGLLAIKFPLLLGNGKGPAQVGFDGSLTLQ
FAAVLLVLRVLITWTSLRAGAAGGLLTPGLCNGALFAIVLGSVWSAWWPGAPLGAFAVIG
AAAFLATSMRVPLTAIALIFEFTRPSPEFMIPVLIAVAGSVAMSSYVRQFFDPARRPDLS
AKAERANV