Protein Info for H281DRAFT_03375 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Dimerisation domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16864: Dimerisation2
  • amino acids 27 to 104 (78 residues), 64.7 bits, E=6.2e-22
• PF00891: Methyltransf_2
  • amino acids 126 to 334 (209 residues), 120.5 bits, E=6.5e-39

Best Hits

Swiss-Prot: 47% identical to TCMO_STRGA: Tetracenomycin polyketide synthesis 8-O-methyl transferase TcmO (tcmO) from Streptomyces glaucescens

KEGG orthology group: None (inferred from 81% identity to bge:BC1002_1107)

MetaCyc: 47% identical to tetracenomycin B3 8-O-methyl transferase (Streptomyces glaucescens)
2.1.1.-

Predicted SEED Role

"O-methyltransferase, family 2"

MetaCyc Pathways

• tetracenomycin C biosynthesis (1/10 steps found)

Protein Sequence (353 amino acids)

>H281DRAFT_03375 Dimerisation domain-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MESTSSMVRQEPGANNPRQQEPSPERLLQLGMGFWASKTLLSAVELGVFSCLATGPRDAA
ELSEALGLHPRSALDFLDALVALNLLEREDGKYRNTPDAGLFLDMAKPSYVGGLLEMANA
RLYPFWGSLTEALRTGLPQNEAKGGGNPFDAMYSDEQKLRCFLRAMSGVSLGAAKAIAQQ
FPWQNYKSFIDIGAAQGALPVQVALAHPHLRGGGFDLPIVGPVFEEYVASHGLQERLNFY
PGDFFRDSCPAADVLVMGHILHDWDLGQKLELLAKCYASLPPGGCLIVYDAVIDDDRRRN
AFGLLMSLNMLIETPGGFDYTGAQCREWMQQVGFTQVRVEPLAGPDSMVIGTK