Protein Info for H281DRAFT_03369 in Paraburkholderia bryophila 376MFSha3.1

Annotation: membrane fusion protein, multidrug efflux system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF16576: HlyD_D23" amino acids 48 to 286 (239 residues), 42.9 bits, see alignment E=7.3e-15 PF13533: Biotin_lipoyl_2" amino acids 51 to 94 (44 residues), 48.9 bits, see alignment 8.8e-17 PF00529: CusB_dom_1" amino acids 97 to 340 (244 residues), 31.9 bits, see alignment E=2.1e-11 PF13437: HlyD_3" amino acids 210 to 293 (84 residues), 52 bits, see alignment E=2.1e-17

Best Hits

Swiss-Prot: 69% identical to MDTN_ECOL6: Multidrug resistance protein MdtN (mdtN) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 69% identity to bur:Bcep18194_C6554)

MetaCyc: 68% identical to putative multidrug efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-351

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>H281DRAFT_03369 membrane fusion protein, multidrug efflux system (Paraburkholderia bryophila 376MFSha3.1)
MATNAGKTKKQAWPAIILVVVTLLLLIFVIRQLDREPRTDDAYVYADTIDVVPEVNGRIV
ELAVRDNQAVKQGDLLFRIDPRPYQDALARGKASLVALDRQIELTQRTVNAQQYNAQSVR
AVVERARAAATQASDTLRRMEPLLSHGYVSAEEVDRARAAQRATQAELSAAQLQAQQAAA
AVSGVDALVAQRAAVMAEIAIADLNLEYATVRAPFDGRIVSLKSSTGQFASVLKPVFTLI
DTRHWYVVANFRETELKDIRTGTPATVYLMSDTGQRFQGTVDSISYGVAPDEGGLALPGG
LPRIQRTLNWVHVAQRFPVKIRVDKPNPELFRVGTSAVAVLHPGRGDDGEAR