Protein Info for H281DRAFT_03362 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF02771: Acyl-CoA_dh_N" amino acids 21 to 131 (111 residues), 78 bits, see alignment E=1.5e-25 PF02770: Acyl-CoA_dh_M" amino acids 136 to 231 (96 residues), 79.4 bits, see alignment E=3.8e-26 PF00441: Acyl-CoA_dh_1" amino acids 245 to 391 (147 residues), 162.6 bits, see alignment E=1.6e-51 PF08028: Acyl-CoA_dh_2" amino acids 259 to 380 (122 residues), 74.9 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: None (inferred from 39% identity to rme:Rmet_5538)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>H281DRAFT_03362 Acyl-CoA dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
VNPEYASNLVNRRDLKPYLNADQFEFRDSVNRVLTRHASPEYVRQCDEEKRFPEELVKVA
AEQGWFGITLPEEYGGVGGYLDMAAYLEIVAYHTIALARFWNANVNMVGGALARFAPDNI
KGEVLPKLAEGRAFLAFALSENGSGSDAASLTTRGVADGNDFILDGTKMWISGAMQADYI
LTAVRTNPEAKKHDGISLFLVPKESRGLTINPIDLLGGHAIRTCEVVYDGVRVPAEMIVG
GLHVGWKKLTTVLSKERIALSAMCVGGAQAAIDLARWYANDRKQFGQSIIDFQAVSHMLA
DMQTRVDAARMMAFRAAKLLDEGETCDVESSQAKYLASDTYVQVATDGIQIMGANGYSAE
YAMQRHYREAKMFQIFGGTNQIQRNIVARALKS