Protein Info for H281DRAFT_03358 in Paraburkholderia bryophila 376MFSha3.1

Annotation: TRAP transporter, DctM subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 212 to 260 (49 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 378 to 404 (27 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details amino acids 481 to 506 (26 residues), see Phobius details amino acids 526 to 557 (32 residues), see Phobius details amino acids 569 to 593 (25 residues), see Phobius details amino acids 612 to 636 (25 residues), see Phobius details PF04290: DctQ" amino acids 54 to 180 (127 residues), 100.4 bits, see alignment E=7.7e-33 PF06808: DctM" amino acids 222 to 629 (408 residues), 351.6 bits, see alignment E=5.7e-109 TIGR00786: TRAP transporter, DctM subunit" amino acids 230 to 631 (402 residues), 298.6 bits, see alignment E=3.3e-93

Best Hits

KEGG orthology group: None (inferred from 62% identity to mrd:Mrad2831_3006)

Predicted SEED Role

"Predicted gluconate TRAP family transporter, DctM subunit" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>H281DRAFT_03358 TRAP transporter, DctM subunit (Paraburkholderia bryophila 376MFSha3.1)
MTSRVHPEQVFAHDMGAPKERHAASKVVRVGSTLDTAIKWITEVPAALLLVAEVVLLLTN
VFCRYVLQDPLIWGDELASILFIWLSMLGAVVALRRGEHMRLTMFVDRMSPQNRAFAETV
GNFIVMTFVLLLVRPATDWAMNEWIISTPALELPNTIPAAAIPVAAALMLVLAITRLLER
SSLRDCLKAFALVAGVAIALYIARQALAPLTALSLVLFFAVGVITIICLGVPIMVAFGVC
TFAYLATVTGAPLTIVVSTMNQGMSSLILLAVPLFILLGALMEAMGLAEAMIRFLASLIG
HKRGGLAYVLIGAMYLVSGISGSKVADMAALAPGLFPEMKKRGANEGDLVAMLSSAAAMS
ETIPPSLVLITIGSVTGVSIAALFTGGFMPAVVGAVALAAVVWFKSRRESLQGVQRASWG
EVGRAFLISLPALALPFVIRAAVVEGIATATEVATIGVAYTCVVGLLLYRRFDWSRLYPI
LVEAASLSGAILIIIGCATAMGWALTQSGFSAQLASMMMAAPGGKLGFLAISAITFVMLG
SFLEGIPAIVLFGPLLFPIARAMGISDVHYAMVVVFAMGLGLFAPPLGLGFYAACAVSKV
DPSAAMRRVWPYLGALAAALVVIVLVPWVSVGFLYVK