Protein Info for H281DRAFT_03356 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glycerate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 36 to 315 (280 residues), 68.7 bits, E=4.1e-23
• PF02826: 2-Hacid_dh_C
  • amino acids 111 to 290 (180 residues), 179 bits, E=6.1e-57

Best Hits

Swiss-Prot: 42% identical to Y1556_HAEIN: Putative 2-hydroxyacid dehydrogenase HI_1556 (HI_1556) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 96% identity to bpy:Bphyt_6350)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Protein Sequence (319 amino acids)

>H281DRAFT_03356 glycerate dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MKWSSSLKTIVFLDRATLSADLPDFPFPHRWIEYPSTTPEHVVERCRDAHIVVTNKVPLS
GDVLEQLPHLELIGVPAAGVNHLDTETCRKRGIGIVACPGYSTISVPEHAFALMLALRRN
LMPYWHDVYAGGWSGSPTFYAELHPIQDLHGSTLGIVGAGHGGKRLAELAGAFGMRVLFA
ERKRARCVRDGYVAFDEVLREADTISLHCPLTDETRHLFGLAEFEQMKRSASLVNAARGG
IVDEGALIEALDRKLIANAALDVLEQEPPAADHPLLSRARTDLIVTPHVAWRTQVAMTRL
VTQLARGIEEHYAQRQLPE