Protein Info for H281DRAFT_03350 in Paraburkholderia bryophila 376MFSha3.1

Annotation: amino acid ABC transporter substrate-binding protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 33 to 247 (215 residues), 226 bits, E=6.3e-71
• PF10613: Lig_chan-Glu_bd
  • amino acids 53 to 124 (72 residues), 36.3 bits, E=8.1e-13
• PF12974: Phosphonate-bd
  • amino acids 119 to 244 (126 residues), 31.6 bits, E=1.8e-11

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 95% identity to bxe:Bxe_B2050)

Predicted SEED Role

"Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)" (TC 3.A.1.3.2)

Protein Sequence (251 amino acids)

>H281DRAFT_03350 amino acid ABC transporter substrate-binding protein, PAAT family (Paraburkholderia bryophila 376MFSha3.1)
MKLQRLLSLACISFAVTFGGFPGAASAQTPDVLNVATDATFPPMEYTENGARTGFDVDLM
NALAKAMGKRVQWTDIDFKGLIPGLIAHRFDAAISGIYITDERAKVVDFTDSYYAGGLAV
LVKSDSPVKTVTDLNGKKVSVQVGTKSVNFLRDNFPQINRVEVEKNQEMFDLVGIGRADA
AVTGKPAAYQVAKTRAGFRVLDKTLTTEAYGIAVRKDEPQLKADLNTALAKIKADGTYAA
IVKKWFGASAQ