Protein Info for H281DRAFT_03349 in Paraburkholderia bryophila 376MFSha3.1

Annotation: amino acid ABC transporter membrane protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 110 (99 residues), 98.6 bits, see alignment E=1.3e-32 PF00528: BPD_transp_1" amino acids 35 to 216 (182 residues), 91.3 bits, see alignment E=3.3e-30

Best Hits

Swiss-Prot: 38% identical to Y4TF_SINFN: Probable amino-acid ABC transporter permease protein y4tF (NGR_a01530) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to bpy:Bphyt_4411)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIT4 at UniProt or InterPro

Protein Sequence (222 amino acids)

>H281DRAFT_03349 amino acid ABC transporter membrane protein, PAAT family (Paraburkholderia bryophila 376MFSha3.1)
MELDFSPVIAGWPDIMHGAIVTVEVTAASLALSCVLGLLIGIGRLTPQRRIVYGFCTAYL
TFFRGTPLLVQLFLLFFGLPQFGILLPAFLCGMLGLGLYSAAYVSEIVRGAIQSVDRGQM
EAARSIGMSSGQAMRAIILPQAIVRMIPPLGNEFIALIKNSALVSLLTIDDLMHEGQKII
SVSYRSLEVYLAIALVYLVLTQATNYALHRVERRLRAGGMVQ